Lineage for d2p74a_ (2p74 A:)
- Root: SCOPe 2.05
Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds) Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
contains a cluster of helices and an alpha+beta sandwichSuperfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) 
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) Protein automated matches [190161] (23 species)
not a true proteinSpecies Escherichia coli [TaxId:562] [187306] (55 PDB entries) 
Domain d2p74a_: 2p74 A: [167042]
automated match to d1iyqa_
complexed with k, po4
Details for d2p74a_
PDB Entry: 2p74 (more details), 0.88 Å
PDB Description: ctx-m-9 class a beta-lactamase apo crystal structure at 0.88 angstrom resolution
PDB Compounds: (A:) Beta-lactamase CTX-M-9aSCOPe Domain Sequences for d2p74a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p74a_ e.3.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
etsavqqklaalekssggrlgvalidtadntqvlyrgderfpmcstskvmaaaavlkqse
tqkqllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggp
ggvtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqra
qlvtwlkgnttgaasiraglptswtagdktgsgdygttndiaviwpqgraplvlvtyftq
pqqnaesrrdvlasaariiaegl
SCOPe Domain Coordinates for d2p74a_:
Click to download the PDB-style file with coordinates for d2p74a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2p74a_:
- d2p74a_ first appeared in SCOPe 2.01
- d2p74a_ appears in SCOPe 2.04
- d2p74a_ appears in SCOPe 2.06
- d2p74a_ appears in the current release, SCOPe 2.08
View in 3D
