Lineage for d2p74a_ (2p74 A:)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1949285Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1949286Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1949287Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1949998Protein automated matches [190161] (23 species)
    not a true protein
  7. 1950053Species Escherichia coli [TaxId:562] [187306] (55 PDB entries)
  8. 1950054Domain d2p74a_: 2p74 A: [167042]
    automated match to d1iyqa_
    complexed with k, po4

Details for d2p74a_

PDB Entry: 2p74 (more details), 0.88 Å

PDB Description: ctx-m-9 class a beta-lactamase apo crystal structure at 0.88 angstrom resolution
PDB Compounds: (A:) Beta-lactamase CTX-M-9a

SCOPe Domain Sequences for d2p74a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p74a_ e.3.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
etsavqqklaalekssggrlgvalidtadntqvlyrgderfpmcstskvmaaaavlkqse
tqkqllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggp
ggvtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqra
qlvtwlkgnttgaasiraglptswtagdktgsgdygttndiaviwpqgraplvlvtyftq
pqqnaesrrdvlasaariiaegl

SCOPe Domain Coordinates for d2p74a_:

Click to download the PDB-style file with coordinates for d2p74a_.
(The format of our PDB-style files is described here.)

Timeline for d2p74a_: