Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
Protein automated matches [226839] (42 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [224896] (40 PDB entries) |
Domain d4dcha2: 4dch A:219-469 [219684] automated match to d1bdga2 complexed with 4dc, glc, iod |
PDB Entry: 4dch (more details), 1.79 Å
SCOPe Domain Sequences for d4dcha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dcha2 c.55.1.0 (A:219-469) automated matches {Human (Homo sapiens) [TaxId: 9606]} qcevgmivgtgcnacymeemqnvelvegdegrmcvntewgafgdsgeldeflleydrlvd essanpgqqlyekliggkymgelvrlvllrlvdenllfhgeaseqlrtrgafetrfvsqv esdtgdrkqiynilstlglrpsttdcdivrracesvstraahmcsaglagvinrmresrs edvmritvgvdgsvyklhpsfkerfhasvrrltpsceitfieseegsgrgaalvsavack kacmlgqlehh
Timeline for d4dcha2: