Lineage for d1fakt2 (1fak T:107-210)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 454980Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 454981Family b.1.2.1: Fibronectin type III [49266] (24 proteins)
  6. 455036Protein Extracellular region of human tissue factor [49267] (2 species)
    tandem of fibronectin type III domains
  7. 455037Species Human (Homo sapiens) [TaxId:9606] [49268] (10 PDB entries)
  8. 455049Domain d1fakt2: 1fak T:107-210 [21958]
    Other proteins in same PDB: d1fakh_, d1faki_, d1fakl1, d1fakl2, d1fakl3

Details for d1fakt2

PDB Entry: 1fak (more details), 2.1 Å

PDB Description: human tissue factor complexed with coagulation factor viia inhibited with a bpti-mutant

SCOP Domain Sequences for d1fakt2:

Sequence, based on SEQRES records: (download)

>d1fakt2 b.1.2.1 (T:107-210) Extracellular region of human tissue factor {Human (Homo sapiens)}
nlgqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywkssssgkk
taktntneflidvdkgenycfsvqavipsrtvnrkstdspvecm

Sequence, based on observed residues (ATOM records): (download)

>d1fakt2 b.1.2.1 (T:107-210) Extracellular region of human tissue factor {Human (Homo sapiens)}
nlgqptiqsfeqkvnvtvedertlvrrnntflslrdvfgkdliytlyywgkktaktntne
flidvycfsvqavipsrtvnrkstdspvecm

SCOP Domain Coordinates for d1fakt2:

Click to download the PDB-style file with coordinates for d1fakt2.
(The format of our PDB-style files is described here.)

Timeline for d1fakt2: