SCOP 1.57: Domain d2hft_1: 2hft 1-106

Lineage for d2hft_1 (2hft 1-106)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (16 proteins)

6. Protein Extracellular region of human tissue factor [49267] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49268] (6 PDB entries)

8. Domain d2hft_1: 2hft 1-106 [21951]

Details for d2hft_1

PDB Entry: 2hft, 1.69 Å

PDB Description: the crystal structure of the extracellular domain of human tissue factor at 1.7 angstroms resolution

SCOP Domain Sequences for d2hft_1:

Sequence, based on SEQRES records:

>d2hft_1 b.1.2.1 (1-106) Extracellular region of human tissue factor {Human (Homo sapiens)}
sgttntvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdlt
deivkdvkqtylarvfsypagnvestgsageplyenspeftpylet

Sequence, based on observed residues (ATOM records):

>d2hft_1 b.1.2.1 (1-106) Extracellular region of human tissue factor {Human (Homo sapiens)}
sgttntvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdlt
deivkdvkqtylarvfsypagnvesteplyenspeftpylet

Timeline for d2hft_1:

• d2hft_1 first appeared (with stable ids) in SCOP 1.55
  
• d2hft_1 appears in SCOP 1.59
  
• d2hft_1 appears in the current release, SCOPe 2.08, called d2hfta1