Class b: All beta proteins [48724] (104 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.2: Fibronectin type III [49265] (1 family) |
Family b.1.2.1: Fibronectin type III [49266] (16 proteins) |
Protein Extracellular region of human tissue factor [49267] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [49268] (6 PDB entries) |
Domain d2hft_1: 2hft 1-106 [21951] |
PDB Entry: 2hft (more details), 1.69 Å
SCOP Domain Sequences for d2hft_1:
Sequence, based on SEQRES records: (download)
>d2hft_1 b.1.2.1 (1-106) Extracellular region of human tissue factor {Human (Homo sapiens)} sgttntvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdlt deivkdvkqtylarvfsypagnvestgsageplyenspeftpylet
>d2hft_1 b.1.2.1 (1-106) Extracellular region of human tissue factor {Human (Homo sapiens)} sgttntvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdlt deivkdvkqtylarvfsypagnvesteplyenspeftpylet
Timeline for d2hft_1: