PDB entry 2hft

View 2hft on RCSB PDB site
Description: the crystal structure of the extracellular domain of human tissue factor at 1.7 angstroms resolution
Deposited on 1995-09-08, released 1996-01-29
The last revision prior to the SCOP 1.57 freeze date was dated 1996-01-29, with a file datestamp of 1996-01-31.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: 0.204
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >2hft_ (-)
    sgttntvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdlt
    deivkdvkqtylarvfsypagnvestgsageplyenspeftpyletnlgqptiqsfeqvg
    tkvnvtvedertlvrrnntflslrdvfgkdliytlyywksssqekgefrsgkktaktntn
    eflidvdkgenycfsvqavipsrtvnrkstdspvecmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hft_ (-)
    sgttntvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdlt
    deivkdvkqtylarvfsypagnvesteplyenspeftpyletnlgqptiqsfeqvgtkvn
    vtvedertlvrrnntflslrdvfgkdliytlyywkssgkktaktntneflidvdkgenyc
    fsvqavipsrtvnrkstdspvecmg