Lineage for d4bh0c_ (4bh0 C:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2385148Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2385149Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2385196Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2385678Protein automated matches [190291] (21 species)
    not a true protein
  7. 2385857Species Influenza virus [TaxId:375457] [193026] (2 PDB entries)
  8. 2385859Domain d4bh0c_: 4bh0 C: [219488]
    Other proteins in same PDB: d4bh0b_, d4bh0d_, d4bh0e2, d4bh0f_
    automated match to d4bgzc_
    complexed with nag, po4

Details for d4bh0c_

PDB Entry: 4bh0 (more details), 2.36 Å

PDB Description: h5 (tyty) influenza virus haemagglutinin in complex with human receptor analogue 6'-sln
PDB Compounds: (C:) Hemagglutinin

SCOPe Domain Sequences for d4bh0c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bh0c_ b.19.1.2 (C:) automated matches {Influenza virus [TaxId: 375457]}
dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvagw
llgnpmcdeflnvpewsyivekinpandlcypgnfndyeelkhllsrinhfekiqiipks
swsdheasagvssacpyqgrssffrnvvwlikkdnayptikrsynntnqedllvlwgihh
pndaaeqtrlyqnpttyisvgtstlnqrlvpkiatrskvngqsgrmeffwtilkpndain
fesngnfiapenaykivkkgdstimkseleygncntkcqtpigainssmpfhnihpltig
ecpkyvkssrlvlatglrn

SCOPe Domain Coordinates for d4bh0c_:

Click to download the PDB-style file with coordinates for d4bh0c_.
(The format of our PDB-style files is described here.)

Timeline for d4bh0c_: