Lineage for d4bcxa_ (4bcx A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1298992Superfamily b.1.10: Clathrin adaptor appendage domain [49348] (4 families) (S)
    contains an additional N-terminal strand
  5. 1299050Family b.1.10.0: automated matches [227132] (1 protein)
    not a true family
  6. 1299051Protein automated matches [226833] (1 species)
    not a true protein
  7. 1299052Species Human (Homo sapiens) [TaxId:9606] [224857] (1 PDB entry)
  8. 1299053Domain d4bcxa_: 4bcx A: [219445]
    automated match to d1iu1b_
    complexed with imd, pdo

Details for d4bcxa_

PDB Entry: 4bcx (more details), 2 Å

PDB Description: gamma 2 adaptin ear domain crystal structure
PDB Compounds: (A:) ap-1 complex subunit gamma-like 2

SCOPe Domain Sequences for d4bcxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bcxa_ b.1.10.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pipdlkvferegvqlnlsfirppenpalllititatnfsegdvthficqaavpkslqlql
qapsgntvpargglpitqlfrilnpnkaplrlklrltydhfhqsvqeifevnnlpveswq

SCOPe Domain Coordinates for d4bcxa_:

Click to download the PDB-style file with coordinates for d4bcxa_.
(The format of our PDB-style files is described here.)

Timeline for d4bcxa_: