| Class b: All beta proteins [48724] (174 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.10: Clathrin adaptor appendage domain [49348] (4 families) ![]() contains an additional N-terminal strand |
| Family b.1.10.0: automated matches [227132] (1 protein) not a true family |
| Protein automated matches [226833] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [224857] (1 PDB entry) |
| Domain d4bcxa_: 4bcx A: [219445] automated match to d1iu1b_ complexed with imd, pdo |
PDB Entry: 4bcx (more details), 2 Å
SCOPe Domain Sequences for d4bcxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bcxa_ b.1.10.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pipdlkvferegvqlnlsfirppenpalllititatnfsegdvthficqaavpkslqlql
qapsgntvpargglpitqlfrilnpnkaplrlklrltydhfhqsvqeifevnnlpveswq
Timeline for d4bcxa_: