Lineage for d1iu1b_ (1iu1 B:)
- Root: SCOPe 2.03
Class b: All beta proteins [48724] (174 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.10: Clathrin adaptor appendage domain [49348] (4 families) 
contains an additional N-terminal strand
Family b.1.10.2: gamma-adaptin C-terminal appendage domain-like [74857] (4 proteins)
consist of a single subdomain
automatically mapped to Pfam PF02883Protein Gamma1-adaptin domain [74858] (1 species) Species Human (Homo sapiens) [TaxId:9606] [74859] (4 PDB entries) 
Domain d1iu1b_: 1iu1 B: [71429]
Details for d1iu1b_
PDB Entry: 1iu1 (more details), 1.8 Å
PDB Description: crystal structure of human gamma1-adaptin ear domain
PDB Compounds: (B:) gamma1-adaptinSCOPe Domain Sequences for d1iu1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iu1b_ b.1.10.2 (B:) Gamma1-adaptin domain {Human (Homo sapiens) [TaxId: 9606]}
iaagipsitaysknglkieftfersntnpsvtvitiqasnsteldmtdfvfqaavpktfq
lqllspsssivpafntgtitqvikvlnpqkqqlrmrikltynhkgsamqdlaevnnfppq
swq
SCOPe Domain Coordinates for d1iu1b_:
Click to download the PDB-style file with coordinates for d1iu1b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1iu1b_:
- d1iu1b_ first appeared in SCOP 1.61
- d1iu1b_ appears in SCOPe 2.02
- d1iu1b_ appears in SCOPe 2.04
- d1iu1b_ appears in the current release, SCOPe 2.08
View in 3D
