SCOP 1.57: Domain d1ramb1: 1ram B:192-291

Lineage for d1ramb1 (1ram B:192-291)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.5: E set domains [49208] (24 proteins)

6. Protein p65 subunit of NF-kappa B (NFKB), C-terminal domain [49253] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [49254] (5 PDB entries)

8. Domain d1ramb1: 1ram B:192-291 [21940]
   Other proteins in same PDB: d1rama2, d1ramb2

Details for d1ramb1

PDB Entry: 1ram, 2.7 Å

PDB Description: a novel dna recognition mode by nf-kb p65 homodimer

SCOP Domain Sequences for d1ramb1:

Sequence; same for both SEQRES and ATOM records:

>d1ramb1 b.1.1.5 (B:192-291) p65 subunit of NF-kappa B (NFKB), C-terminal domain {Mouse (Mus musculus)}
aelkicrvnrnsgsclggdeifllcdkvqkedievyftgpgweargsfsqadvhrqvaiv
frtppyadpslqapvrvsmqlrrpsdrelsepmefqylpd

Timeline for d1ramb1:

• d1ramb1 first appeared (with stable ids) in SCOP 1.55
  
• d1ramb1 appears in SCOP 1.59
  
• d1ramb1 appears in the current release, SCOPe 2.08