![]() | Class b: All beta proteins [48724] (93 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.5: E set domains [49208] (23 proteins) |
![]() | Protein p65 subunit of NF-kappa B (NFKB), C-terminal domain [49253] (2 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [49254] (5 PDB entries) |
![]() | Domain d1ramb1: 1ram B:192-291 [21940] Other proteins in same PDB: d1rama2, d1ramb2 |
PDB Entry: 1ram (more details), 2.7 Å
SCOP Domain Sequences for d1ramb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ramb1 b.1.1.5 (B:192-291) p65 subunit of NF-kappa B (NFKB), C-terminal domain {Mouse (Mus musculus)} aelkicrvnrnsgsclggdeifllcdkvqkedievyftgpgweargsfsqadvhrqvaiv frtppyadpslqapvrvsmqlrrpsdrelsepmefqylpd
Timeline for d1ramb1: