Lineage for d4b6pa_ (4b6p A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2466085Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families) (S)
  5. 2466086Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (2 proteins)
    automatically mapped to Pfam PF01220
  6. 2466087Protein Type II 3-dehydroquinate dehydratase [52306] (6 species)
  7. 2466134Species Mycobacterium tuberculosis [TaxId:1773] [52307] (16 PDB entries)
  8. 2466145Domain d4b6pa_: 4b6p A: [219342]
    automated match to d1h05a_
    complexed with 2hn, so4

Details for d4b6pa_

PDB Entry: 4b6p (more details), 2.3 Å

PDB Description: structure of mycobacterium tuberculosis type ii dehydroquinase inhibited by (2s)-2-perfluorobenzyl-3-dehydroquinic acid
PDB Compounds: (A:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d4b6pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4b6pa_ c.23.13.1 (A:) Type II 3-dehydroquinate dehydratase {Mycobacterium tuberculosis [TaxId: 1773]}
livnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqlldwi
hqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiat
gvivglgiqgyllalrylaehv

SCOPe Domain Coordinates for d4b6pa_:

Click to download the PDB-style file with coordinates for d4b6pa_.
(The format of our PDB-style files is described here.)

Timeline for d4b6pa_: