Lineage for d4b4zb_ (4b4z B:)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2244155Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2244156Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2245241Family e.3.1.3: Dac-like [144040] (3 proteins)
    Pfam PF02113; D-Ala-D-Ala carboxypeptidase 3 (S13) family; contains a large insertion comprising two subdomains: (d1) aplha+beta with topological similarity to one subunit of the DTD-like family (69501) and (d2) six-stranded beta-sandwich with a crossed-loop topology
  6. 2245242Protein D-alanyl-D-alanine carboxypeptidase Dac [144043] (1 species)
  7. 2245243Species Actinomadura sp. [TaxId:1989] [144044] (19 PDB entries)
    Uniprot P39045 50-516
  8. 2245261Domain d4b4zb_: 4b4z B: [219329]
    automated match to d2wked_
    complexed with bsf, mg, so4

Details for d4b4zb_

PDB Entry: 4b4z (more details), 2.2 Å

PDB Description: Crystal structure of a complex between Actinomadura R39 DD-peptidase and a sulfonamide boronate inhibitor
PDB Compounds: (B:) d-alanyl-d-alanine carboxypeptidase

SCOPe Domain Sequences for d4b4zb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4b4zb_ e.3.1.3 (B:) D-alanyl-D-alanine carboxypeptidase Dac {Actinomadura sp. [TaxId: 1989]}
rltelredidailedpalegavsgvvvvdtatgeelysrdggeqllpasnmklftaaaal
evlgadhsfgtevaaesapgrrgevqdlylvgrgdptlsaedldamaaevaasgvrtvrg
dlyaddtwfdserlvddwwpedepyaysaqisaltvahgerfdtgvtevsvtpaaegepa
dvdlgaaegyaeldnravtgaagsantlvidrpvgtntiavtgslpadaapvtalrtvde
paalaghlfeealesngvtvkgdvglggvpadwqdaevladhtsaelseilvpfmkfsnn
ghaemlvksigqetagagtwdaglvgveealsglgvdtaglvlndgsglsrgnlvtadtv
vdllgqagsapwaqtwsaslpvagesdpfvggtlanrmrgtaaegvveaktgtmsgvsal
sgyvpgpegelafsivnnghsgpaplavqdaiavrlaeyaghqape

SCOPe Domain Coordinates for d4b4zb_:

Click to download the PDB-style file with coordinates for d4b4zb_.
(The format of our PDB-style files is described here.)

Timeline for d4b4zb_: