SCOP 1.65: Domain d1iknc_: 1ikn C:

Lineage for d1iknc_ (1ikn C:)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (18 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (5 proteins)
   subgroup of the larger IPT/TIG domain family

6. Protein p50 subunit of NF-kappa B transcription factor [49248] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [49250] (8 PDB entries)

8. Domain d1iknc_: 1ikn C: [21928]
   Other proteins in same PDB: d1ikna1, d1ikna2, d1iknd_

Details for d1iknc_

PDB Entry: 1ikn, 2.3 Å

PDB Description: ikappabalpha/nf-kappab complex

SCOP Domain Sequences for d1iknc_:

Sequence; same for both SEQRES and ATOM records:

>d1iknc_ b.1.18.1 (C:) p50 subunit of NF-kappa B transcription factor {Mouse (Mus musculus)}
asnlkivrmdrtagcvtggeeiyllcdkvqkddiqirfyeeeenggvwegfgdfsptdvh
rqfaivfktpkykdvnitkpasvfvqlrrksdletsepkpflyypeikdkeev

Timeline for d1iknc_:

• d1iknc_ first appeared (with stable ids) in SCOP 1.55
  
• d1iknc_ appears in SCOP 1.63
  
• d1iknc_ appears in SCOP 1.67
  
• d1iknc_ appears in the current release, SCOPe 2.08