Lineage for d1iknc_ (1ikn C:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 9579Family b.1.1.5: E set domains [49208] (23 protein domains)
  6. 9713Protein p50 subunit of NF-kappa B transcription factor, C-terminal domain [49248] (2 species)
  7. 9718Species Mouse (Mus musculus) [TaxId:10090] [49250] (4 PDB entries)
  8. 9720Domain d1iknc_: 1ikn C: [21928]
    Other proteins in same PDB: d1ikna1, d1ikna2, d1iknd_

Details for d1iknc_

PDB Entry: 1ikn (more details), 2.3 Å

PDB Description: ikappabalpha/nf-kappab complex

SCOP Domain Sequences for d1iknc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iknc_ b.1.1.5 (C:) p50 subunit of NF-kappa B transcription factor, C-terminal domain {Mouse (Mus musculus)}
asnlkivrmdrtagcvtggeeiyllcdkvqkddiqirfyeeeenggvwegfgdfsptdvh
rqfaivfktpkykdvnitkpasvfvqlrrksdletsepkpflyypeikdkeev

SCOP Domain Coordinates for d1iknc_:

Click to download the PDB-style file with coordinates for d1iknc_.
(The format of our PDB-style files is described here.)

Timeline for d1iknc_: