Lineage for d1ayrc2 (1ayr C:183-368)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2765812Family b.1.18.11: Arrestin/Vps26-like [81291] (2 proteins)
  6. 2765813Protein Arrestin [49244] (3 species)
    duplication: contains tandem repeat of two elaborated Ig-like domains contacting each other head-to-head
  7. 2765829Species Cow (Bos taurus), visual arrestin [TaxId:9913] [49245] (2 PDB entries)
  8. 2765843Domain d1ayrc2: 1ayr C:183-368 [21920]

Details for d1ayrc2

PDB Entry: 1ayr (more details), 3.3 Å

PDB Description: arrestin from bovine rod outer segments
PDB Compounds: (C:) arrestin

SCOPe Domain Sequences for d1ayrc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ayrc2 b.1.18.11 (C:183-368) Arrestin {Cow (Bos taurus), visual arrestin [TaxId: 9913]}
dmgpqpraeaswqffmsdkplrlavslskeiyyhgepipvtvavtnstektvkkikvlve
qvtnvvlyssdyyiktvaaeeaqekvppnssltktltlvpllannrerrgialdgkikhe
dtnlasstiikegidktvmgilvsyqikvkltvsgllgeltssevatevpfrlmhpqped
pdtaka

SCOPe Domain Coordinates for d1ayrc2:

Click to download the PDB-style file with coordinates for d1ayrc2.
(The format of our PDB-style files is described here.)

Timeline for d1ayrc2: