SCOPe 2.07: Domain d4auxa2: 4aux A:68-208

Lineage for d4auxa2 (4aux A:68-208)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
   multihelical; interlocked (homo)dimer

4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families)

5. Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 protein domains)

6. Protein Tetracyclin repressor (Tet-repressor, TetR) [48500] (1 species)

7. Species Escherichia coli [TaxId:562] [48501] (28 PDB entries)

8. Domain d4auxa2: 4aux A:68-208 [219162]
   Other proteins in same PDB: d4auxa1
   automated match to d2tcta2
   complexed with cl, mg, xtc

Details for d4auxa2

PDB Entry: 4aux, 2.25 Å

PDB Description: Tet repressor class D in complex with 9-nitrotetracycline

PDB Compounds: (A:) tetracycline repressor protein class d

SCOPe Domain Sequences for d4auxa2:

Sequence; same for both SEQRES and ATOM records:

>d4auxa2 a.121.1.1 (A:68-208) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
lpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsddgeqafl
hgleslirgfevqltallqiv

Timeline for d4auxa2:

• d4auxa2 first appeared in SCOPe 2.03
  
• d4auxa2 appears in SCOPe 2.06