Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (12 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [224855] (237 PDB entries) |
Domain d4at6n2: 4at6 N:111-212 [219146] Other proteins in same PDB: d4at6b1, d4at6d1, d4at6f1, d4at6i1, d4at6k1, d4at6l1, d4at6n1, d4at6p1 automated match to d1q0xl2 |
PDB Entry: 4at6 (more details), 2.55 Å
SCOPe Domain Sequences for d4at6n2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4at6n2 b.1.1.2 (N:111-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]} qpksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskq snnkymassyltltarawerhssyscqvtheghtvekslsra
Timeline for d4at6n2: