SCOPe 2.03: Domain d4at6b1: 4at6 B:1-110

Lineage for d4at6b1 (4at6 B:1-110)

Root: SCOPe 2.03
Class b: All beta proteins [48724] (174 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
Protein automated matches [190119] (16 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [186842] (99 PDB entries)
Domain d4at6b1: 4at6 B:1-110 [219133]
Other proteins in same PDB: d4at6b2, d4at6d2, d4at6f2, d4at6i2, d4at6k2, d4at6l2, d4at6n2, d4at6p2
automated match to d1q0xl1

Details for d4at6b1

PDB Entry: 4at6 (more details), 2.55 Å

PDB Description: fab fragment of antiporphyrin antibody 14h7

PDB Compounds: (B:) fab 14h7 light chain

SCOPe Domain Sequences for d4at6b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4at6b1 b.1.1.1 (B:1-110) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qavvtqesalttspgetvtltcrsstgavttsnyanwvqetpdhlftgliggtnnrapgv
parfsgsligdkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvlg

SCOPe Domain Coordinates for d4at6b1:

Click to download the PDB-style file with coordinates for d4at6b1.
(The format of our PDB-style files is described here.)

Timeline for d4at6b1: