SCOPe 2.04: Domain d4aqpc_: 4aqp C:

Lineage for d4aqpc_ (4aqp C:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.145: AXH domain [102030] (1 superfamily)
   pseudobarrel; some similarity to OB-fold

4. Superfamily b.145.1: AXH domain [102031] (2 families)
   automatically mapped to Pfam PF08517

5. Family b.145.1.1: AXH domain [102032] (2 proteins)

6. Protein automated matches [196747] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [196748] (4 PDB entries)

8. Domain d4aqpc_: 4aqp C: [219114]
   automated match to d4apta_
   complexed with na, peg

Details for d4aqpc_

PDB Entry: 4aqp, 2.45 Å

PDB Description: The structure of the AXH domain of ataxin-1.

PDB Compounds: (C:) ataxin-1

SCOPe Domain Sequences for d4aqpc_:

Sequence; same for both SEQRES and ATOM records:

>d4aqpc_ b.145.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gamapptlppyfmkgsiiqlangelkkvedlktedfiqsaeisndlkidsstveriedsh
spgvaviqfavgehraqvsvevlveypffvfgqgwssccpertsqlfdlpcsklsvgdvc
isltlk

Timeline for d4aqpc_:

• d4aqpc_ first appeared in SCOPe 2.03
  
• d4aqpc_ appears in SCOPe 2.05
  
• d4aqpc_ appears in the current release, SCOPe 2.08, called d4aqpc1