Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.1: Class II glutamine amidotransferases [56236] (6 proteins) has slightly different topology than other families do |
Protein Glucosamine 6-phosphate synthase, N-terminal domain [56237] (1 species) |
Species Escherichia coli [TaxId:562] [56238] (4 PDB entries) Uniprot P17169 1-238 |
Domain d4amvc2: 4amv C:1-240 [219061] Other proteins in same PDB: d4amva1, d4amvb1, d4amvc1 complexed with f6r |
PDB Entry: 4amv (more details), 2.05 Å
SCOPe Domain Sequences for d4amvc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4amvc2 d.153.1.1 (C:1-240) Glucosamine 6-phosphate synthase, N-terminal domain {Escherichia coli [TaxId: 562]} cgivgaiaqrdvaeilleglrrleyrgydsaglavvdaeghmtrlrrlgkvqmlaqaaee hplhggtgiahtrwathgepsevnahphvsehivvvhngiienheplreelkargytfvs etdteviahlvnwelkqggtlreavlraipqlrgaygtvimdsrhpdtllaarsgsplvi glgmgenfiasdqlallpvtrrfifleegdiaeitrrsvnifdktgaevkrqdiesnlqy
Timeline for d4amvc2:
View in 3D Domains from other chains: (mouse over for more information) d4amva1, d4amva2, d4amvb1, d4amvb2 |