Lineage for d4amua2 (4amu A:154-342)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1620378Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 1620379Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 1620829Family c.78.1.0: automated matches [227206] (1 protein)
    not a true family
  6. 1620830Protein automated matches [226938] (22 species)
    not a true protein
  7. 1620970Species Mycoplasma penetrans [TaxId:28227] [226338] (2 PDB entries)
  8. 1620972Domain d4amua2: 4amu A:154-342 [219049]
    automated match to d1duvg2

Details for d4amua2

PDB Entry: 4amu (more details), 2.5 Å

PDB Description: Structure of ornithine carbamoyltransferase from Mycoplasma penetrans with a P321 space group
PDB Compounds: (A:) ornithine carbamoyltransferase, catabolic

SCOPe Domain Sequences for d4amua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4amua2 c.78.1.0 (A:154-342) automated matches {Mycoplasma penetrans [TaxId: 28227]}
nlknkkivfigdyknnvgvstmigaafngmhvvmcgpdnykneidknvlakcielfkrng
gslrfstdkilaaqdadviytdvwvslgepfelfdkrigelknfqvdmnmikaakndvif
lhclpafhddhtsfskevattlgakypivakgemevtdevfqslhnkafdqaenrmhsik
aiilstigy

SCOPe Domain Coordinates for d4amua2:

Click to download the PDB-style file with coordinates for d4amua2.
(The format of our PDB-style files is described here.)

Timeline for d4amua2: