Lineage for d4al3a_ (4al3 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3000942Fold d.167: Peptide deformylase [56419] (1 superfamily)
    alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix
  4. 3000943Superfamily d.167.1: Peptide deformylase [56420] (2 families) (S)
    nickel-dependent enzyme
  5. 3000944Family d.167.1.1: Peptide deformylase [56421] (2 proteins)
    automatically mapped to Pfam PF01327
  6. 3001072Protein automated matches [190200] (9 species)
    not a true protein
  7. 3001092Species Escherichia coli [TaxId:469008] [194798] (3 PDB entries)
  8. 3001094Domain d4al3a_: 4al3 A: [219019]
    automated match to d4az4a_
    complexed with bme, cl, co

Details for d4al3a_

PDB Entry: 4al3 (more details), 1.98 Å

PDB Description: peptide deformylase (co-form) with mercaptoethanol
PDB Compounds: (A:) Peptide deformylase

SCOPe Domain Sequences for d4al3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4al3a_ d.167.1.1 (A:) automated matches {Escherichia coli [TaxId: 469008]}
svlqvlhipderlrkvakpveevnaeiqrivddmfetmyaeegiglaatqvdihqriivi
dvsenrderlvlinpelleksgetgieegclsipeqralvpraekvkiraldrdgkpfel
eadgllaiciqhemdhlvgklfmdylsplkqqrirqkvekld

SCOPe Domain Coordinates for d4al3a_:

Click to download the PDB-style file with coordinates for d4al3a_.
(The format of our PDB-style files is described here.)

Timeline for d4al3a_: