SCOPe 2.08: Domain d4aj0b1: 4aj0 B:1-95

Lineage for d4aj0b1 (4aj0 B:1-95)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)

8. Domain d4aj0b1: 4aj0 B:1-95 [218905]
   Other proteins in same PDB: d4aj0a2, d4aj0b2, d4aj0c2, d4aj0d2
   automated match to d1cd0b_
   complexed with act, pg0

Details for d4aj0b1

PDB Entry: 4aj0, 1.7 Å

PDB Description: Crystallographic structure of an amyloidogenic variant, 3rCW, of the germinal line lambda 3

PDB Compounds: (B:) germinal line lambda 3 3rcw variant

SCOPe Domain Sequences for d4aj0b1:

Sequence; same for both SEQRES and ATOM records:

>d4aj0b1 b.1.1.1 (B:1-95) automated matches {Human (Homo sapiens) [TaxId: 9606]}
syeltqppsvsvspgqtasitcsgdklgdkyaywyqqkpgqspvlviyqdskrpsgiper
fsgsnsgntatltisgtqamdeadyycqaadssta

Timeline for d4aj0b1:

• d4aj0b1 first appeared in SCOPe 2.03, called d4aj0b_
  
• d4aj0b1 was called d4aj0b_ in SCOPe 2.07