Lineage for d4aizb_ (4aiz B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2365799Domain d4aizb_: 4aiz B: [218901]
    automated match to d1cd0b_
    complexed with 88q, cit, so4

Details for d4aizb_

PDB Entry: 4aiz (more details), 1.75 Å

PDB Description: Crystallographic structure of 3mJL2 from the germinal line lambda 3
PDB Compounds: (B:) v2-17 protein

SCOPe Domain Sequences for d4aizb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4aizb_ b.1.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
elmqppsvsvspgqtaritcsgdalpkqyaywyqqkpgqapvlviykdserpsgiperfs
gsssgttvtltisgvqaedeadyycqsadssgtyvvfgggtklvvl

SCOPe Domain Coordinates for d4aizb_:

Click to download the PDB-style file with coordinates for d4aizb_.
(The format of our PDB-style files is described here.)

Timeline for d4aizb_: