Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.135: The spindle assembly checkpoint protein mad2 [56018] (1 superfamily) core: alpha(2)-beta(2)-alpha-beta; mixed sheet: order 213 |
Superfamily d.135.1: The spindle assembly checkpoint protein mad2 [56019] (2 families) N- and C-termini undergo large conformational rearrangement upon ligand binding automatically mapped to Pfam PF02301 |
Family d.135.1.0: automated matches [227274] (1 protein) not a true family |
Protein automated matches [227080] (1 species) not a true protein |
Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [226328] (1 PDB entry) |
Domain d4aezb_: 4aez B: [218817] automated match to d1go4a_ |
PDB Entry: 4aez (more details), 2.3 Å
SCOPe Domain Sequences for d4aezb_:
Sequence, based on SEQRES records: (download)
>d4aezb_ d.135.1.0 (B:) automated matches {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} kgssklvseffeyavnsilfqrgiypaedfkvvrkyglnmlvsvdeevktyirkivsqlh kwmfakkiqklilvitskcsgedlerwqfnvemvdtadqfqnignkedelrvqkeiqali aqitatvtflpqleeqctfnvlvyadkdsevptdwvdsdprilrdaeqvqlrsfstsmhk idcqvayrv
>d4aezb_ d.135.1.0 (B:) automated matches {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} kgssklvseffeyavnsilfqrgiypaedfkvvrkyglnmlvsvdeevktyirkivsqlh kwmfakkiqklilvitskcsgedlerwqfnvemvdnkedelrvqkeiqaliaqitatvtf lpqleeqctfnvlvyadkdsevptdwvdsdprilrdaeqvqlrsfstsmhkidcqvayrv
Timeline for d4aezb_: