Lineage for d4aeze_ (4aez E:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2977796Fold d.135: The spindle assembly checkpoint protein mad2 [56018] (1 superfamily)
    core: alpha(2)-beta(2)-alpha-beta; mixed sheet: order 213
  4. 2977797Superfamily d.135.1: The spindle assembly checkpoint protein mad2 [56019] (2 families) (S)
    N- and C-termini undergo large conformational rearrangement upon ligand binding
    automatically mapped to Pfam PF02301
  5. 2977830Family d.135.1.0: automated matches [227274] (1 protein)
    not a true family
  6. 2977831Protein automated matches [227080] (1 species)
    not a true protein
  7. 2977832Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [226328] (1 PDB entry)
  8. 2977834Domain d4aeze_: 4aez E: [218818]
    automated match to d1go4a_

Details for d4aeze_

PDB Entry: 4aez (more details), 2.3 Å

PDB Description: crystal structure of mitotic checkpoint complex
PDB Compounds: (E:) mitotic spindle checkpoint component mad2

SCOPe Domain Sequences for d4aeze_:

Sequence, based on SEQRES records: (download)

>d4aeze_ d.135.1.0 (E:) automated matches {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
gssklvseffeyavnsilfqrgiypaedfkvvrkyglnmlvsvdeevktyirkivsqlhk
wmfakkiqklilvitskcsgedlerwqfnvemvdtadqfqnignkedelrvqkeiqalia
qitatvtflpqleeqctfnvlvyadkdsevptdwvdsdprilrdaeqvqlrsfstsmhki
dcqvayrvn

Sequence, based on observed residues (ATOM records): (download)

>d4aeze_ d.135.1.0 (E:) automated matches {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
gssklvseffeyavnsilfqrgiypaedfkvvrkyglnmlvsvdeevktyirkivsqlhk
wmfakkiqklilvitskcsgedlerwqfnvemdelrvqkeiqaliaqitatvtflpqlee
qctfnvlvyadkdsevptdwvdsdprilrdaeqvqlrsfstsmhkidcqvayrvn

SCOPe Domain Coordinates for d4aeze_:

Click to download the PDB-style file with coordinates for d4aeze_.
(The format of our PDB-style files is described here.)

Timeline for d4aeze_: