Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily) duplication: common core consists of two beta-alpha-beta2-alpha repeats |
Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) |
Family d.128.1.0: automated matches [227250] (1 protein) not a true family |
Protein automated matches [227028] (5 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83332] [226759] (6 PDB entries) |
Domain d4acfa2: 4acf A:105-478 [218783] Other proteins in same PDB: d4acfa1, d4acfb1, d4acfc1, d4acfd1, d4acfe1, d4acff1 automated match to d1f52a2 complexed with 46b, cl, mg, p3s, po4 |
PDB Entry: 4acf (more details), 2 Å
SCOPe Domain Sequences for d4acfa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4acfa2 d.128.1.0 (A:105-478) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} srdprniarkaenylistgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwnt gaateadgspnrgykvrhkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsgg qaeinyqfnsllhaaddmqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkd gaplmydetgyaglsdtarhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysq rnrsacvripitgsnpkakrlefrspdssgnpylafsamlmagldgiknkiepqapvdkd lyelppeeaasipqtptqlsdvidrleadheylteggvftndlietwisfkreneiepvn irphpyefalyydv
Timeline for d4acfa2: