SCOPe 2.07: Domain d4ab4a1: 4ab4 A:2-349

Lineage for d4ab4a1 (4ab4 A:2-349)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families)

5. Family c.1.4.0: automated matches [191310] (1 protein)
   not a true family

6. Protein automated matches [190048] (31 species)
   not a true protein

7. Species Pseudomonas putida [TaxId:160488] [194066] (2 PDB entries)

8. Domain d4ab4a1: 4ab4 A:2-349 [218764]
   Other proteins in same PDB: d4ab4a2, d4ab4b2
   automated match to d4aeob_
   complexed with edo, fmn, gol, so4, tnl

Details for d4ab4a1

PDB Entry: 4ab4, 1.5 Å

PDB Description: Structure of Xenobiotic Reductase B from Pseudomonas putida in complex with TNT

PDB Compounds: (A:) xenobiotic reductase b

SCOPe Domain Sequences for d4ab4a1:

Sequence; same for both SEQRES and ATOM records:

>d4ab4a1 c.1.4.0 (A:2-349) automated matches {Pseudomonas putida [TaxId: 160488]}
ttlfdpiklgdlqlpnriimapltrcradegrvpnalmaeyyvqrasaglilseatsvsp
mgvgypdtpgiwndeqvrgwnnvtkavhaaggriflqlwhvgrishpsylngelpvapsa
iqpkghvslvrplsdyptpraleteeindiveayrsgaenakaagfdgveihgangylld
qflqsstnqrtdryggslenrarlllevtdaaievwgaqrvgvhlapradahdmgdadra
etftyvarelgkrgiaficsrereaddsigplikeafggpyivnerfdkasanaalasgk
adavafgvpfianpdlparlaadaplneahpetfygkgpvgyidyprl

Timeline for d4ab4a1:

• d4ab4a1 first appeared in SCOPe 2.03, called d4ab4a_
  
• d4ab4a1 appears in SCOPe 2.06
  
• d4ab4a1 appears in the current release, SCOPe 2.08