Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) |
Family c.1.4.0: automated matches [191310] (1 protein) not a true family |
Protein automated matches [190048] (31 species) not a true protein |
Species Pseudomonas putida [TaxId:160488] [194066] (2 PDB entries) |
Domain d4ab4a1: 4ab4 A:2-349 [218764] Other proteins in same PDB: d4ab4a2, d4ab4b2 automated match to d4aeob_ complexed with edo, fmn, gol, so4, tnl |
PDB Entry: 4ab4 (more details), 1.5 Å
SCOPe Domain Sequences for d4ab4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ab4a1 c.1.4.0 (A:2-349) automated matches {Pseudomonas putida [TaxId: 160488]} ttlfdpiklgdlqlpnriimapltrcradegrvpnalmaeyyvqrasaglilseatsvsp mgvgypdtpgiwndeqvrgwnnvtkavhaaggriflqlwhvgrishpsylngelpvapsa iqpkghvslvrplsdyptpraleteeindiveayrsgaenakaagfdgveihgangylld qflqsstnqrtdryggslenrarlllevtdaaievwgaqrvgvhlapradahdmgdadra etftyvarelgkrgiaficsrereaddsigplikeafggpyivnerfdkasanaalasgk adavafgvpfianpdlparlaadaplneahpetfygkgpvgyidyprl
Timeline for d4ab4a1: