![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
![]() | Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) ![]() superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands |
![]() | Family b.81.1.4: GlmU C-terminal domain-like [51171] (4 proteins) this is a repeat family; one repeat unit is 2oi5 A:321-339 found in domain |
![]() | Protein automated matches [227078] (2 species) not a true protein |
![]() | Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [226303] (2 PDB entries) |
![]() | Domain d4aawa2: 4aaw A:252-459 [218763] Other proteins in same PDB: d4aawa1 automated match to d1g95a1 complexed with r84, so4 |
PDB Entry: 4aaw (more details), 2.2 Å
SCOPe Domain Sequences for d4aawa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4aawa2 b.81.1.4 (A:252-459) automated matches {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} vsfvnpeatyididveiapevqieanvilkgqtkigaetvltngtyvvdstigagavitn smieessvadgvtvgpyahirpnsslgaqvhignfvevkgssigentkaghltyigncev gsnvnfgagtitvnydgknkyktvigdnvfvgsnstiiapvelgdnslvgagstitkdvp adaiaigrgrqinkdeyatrlphhpknq
Timeline for d4aawa2: