Lineage for d4aawa2 (4aaw A:252-459)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2813832Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2813833Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 2814014Family b.81.1.4: GlmU C-terminal domain-like [51171] (4 proteins)
    this is a repeat family; one repeat unit is 2oi5 A:321-339 found in domain
  6. 2814064Protein automated matches [227078] (2 species)
    not a true protein
  7. 2814068Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [226303] (2 PDB entries)
  8. 2814070Domain d4aawa2: 4aaw A:252-459 [218763]
    Other proteins in same PDB: d4aawa1
    automated match to d1g95a1
    complexed with r84, so4

Details for d4aawa2

PDB Entry: 4aaw (more details), 2.2 Å

PDB Description: s.pneumoniae glmu in complex with an antibacterial inhibitor
PDB Compounds: (A:) Bifunctional protein glmU

SCOPe Domain Sequences for d4aawa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4aawa2 b.81.1.4 (A:252-459) automated matches {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
vsfvnpeatyididveiapevqieanvilkgqtkigaetvltngtyvvdstigagavitn
smieessvadgvtvgpyahirpnsslgaqvhignfvevkgssigentkaghltyigncev
gsnvnfgagtitvnydgknkyktvigdnvfvgsnstiiapvelgdnslvgagstitkdvp
adaiaigrgrqinkdeyatrlphhpknq

SCOPe Domain Coordinates for d4aawa2:

Click to download the PDB-style file with coordinates for d4aawa2.
(The format of our PDB-style files is described here.)

Timeline for d4aawa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4aawa1