PDB entry 4aaw

View 4aaw on RCSB PDB site
Description: S.pneumoniae GlmU in complex with an antibacterial inhibitor
Class: transferase
Keywords: transferase, transferase inhibitor complex
Deposited on 2011-12-05, released 2012-02-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-08-15, with a file datestamp of 2012-08-10.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.20164
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bifunctional protein glmU
    Species: Streptococcus pneumoniae [TaxId:1313]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4aawa1, d4aawa2
  • Heterogens: R84, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4aawA (A:)
    msnfaiilaagkgtrmksdlpkvlhkvagismlehvfrsvgaiqpektvtvvghkaelve
    evlaeqtefvtqseqlgtghavmmtepileglsghtlviagdtplitgeslknlidfhin
    hknvatiltaetdnpfgygrivrndnaevlriveqkdatdfekqikeintgtyvfdnerl
    fealknintnnaqgeyyitdvigifretgekvgaytlkdfdeslgvndrvalataesvmr
    rrinhkhmvngvsfvnpeatyididveiapevqieanvilkgqtkigaetvltngtyvvd
    stigagavitnsmieessvadgvtvgpyahirpnsslgaqvhignfvevkgssigentka
    ghltyigncevgsnvnfgagtitvnydgknkyktvigdnvfvgsnstiiapvelgdnslv
    gagstitkdvpadaiaigrgrqinkdeyatrlphhpknq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4aawA (A:)
    snfaiilaagkgtrmksdlpkvlhkvagismlehvfrsvgaiqpektvtvvghkaelvee
    vlaeqtefvtqseqlgtghavmmtepileglsghtlviagdtplitgeslknlidfhinh
    knvatiltaetdnpfgygrivrndnaevlriveqkdatdfekqikeintgtyvfdnerlf
    ealknintnneyyitdvigifretgekvgaytlkdfdeslgvndrvalataesvmrrrin
    hkhmvngvsfvnpeatyididveiapevqieanvilkgqtkigaetvltngtyvvdstig
    agavitnsmieessvadgvtvgpyahirpnsslgaqvhignfvevkgssigentkaghlt
    yigncevgsnvnfgagtitvnydgknkyktvigdnvfvgsnstiiapvelgdnslvgags
    titkdvpadaiaigrgrqinkdeyatrlphhpknq