![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
![]() | Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
![]() | Family a.3.1.0: automated matches [191374] (1 protein) not a true family |
![]() | Protein automated matches [190453] (26 species) not a true protein |
![]() | Species Geobacter sulfurreducens [TaxId:243231] [226497] (6 PDB entries) |
![]() | Domain d4aala1: 4aal A:23-188 [218750] automated match to d1nmla1 complexed with act, ca, eoh, hec, po4 |
PDB Entry: 4aal (more details), 1.84 Å
SCOPe Domain Sequences for d4aala1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4aala1 a.3.1.0 (A:23-188) automated matches {Geobacter sulfurreducens [TaxId: 243231]} edvmkraqglfkpipakppvmkdnpaspsrvelgrmlffdprlsashliscntchnvglg gtdiletsighgwqkgprnsptvlnavyniaqfwdgraedlaaqakgpvqasvemnnkpe nlvatlksipgypplfrkafpgqgdpvtfdnvakaievfeatlvtp
Timeline for d4aala1: