SCOPe 2.07: Domain d4aala1: 4aal A:23-188

Lineage for d4aala1 (4aal A:23-188)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.0: automated matches [191374] (1 protein)
   not a true family

6. Protein automated matches [190453] (23 species)
   not a true protein

7. Species Geobacter sulfurreducens [TaxId:243231] [226497] (5 PDB entries)

8. Domain d4aala1: 4aal A:23-188 [218750]
   automated match to d1nmla1
   complexed with act, ca, eoh, hec, po4

Details for d4aala1

PDB Entry: 4aal, 1.84 Å

PDB Description: MacA wild-type oxidized

PDB Compounds: (A:) cytochrome c551 peroxidase

SCOPe Domain Sequences for d4aala1:

Sequence; same for both SEQRES and ATOM records:

>d4aala1 a.3.1.0 (A:23-188) automated matches {Geobacter sulfurreducens [TaxId: 243231]}
edvmkraqglfkpipakppvmkdnpaspsrvelgrmlffdprlsashliscntchnvglg
gtdiletsighgwqkgprnsptvlnavyniaqfwdgraedlaaqakgpvqasvemnnkpe
nlvatlksipgypplfrkafpgqgdpvtfdnvakaievfeatlvtp

Timeline for d4aala1:

• d4aala1 first appeared in SCOPe 2.03
  
• d4aala1 appears in SCOPe 2.06