Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.37: ABC transporter transmembrane region [90122] (1 superfamily) multihelical; complex architecture with several transmembrane helices |
Superfamily f.37.1: ABC transporter transmembrane region [90123] (2 families) automatically mapped to Pfam PF00664 |
Family f.37.1.1: ABC transporter transmembrane region [90124] (4 proteins) |
Protein Putative multidrug export ATP-binding/permease protein SAV1866 [144087] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [224951] (1 PDB entry) |
Domain d4a82c1: 4a82 C:1-323 [218706] Other proteins in same PDB: d4a82a2, d4a82b2, d4a82c2, d4a82d2 automated match to d2hyda2 |
PDB Entry: 4a82 (more details), 2 Å
SCOPe Domain Sequences for d4a82c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4a82c1 f.37.1.1 (C:1-323) Putative multidrug export ATP-binding/permease protein SAV1866 {Human (Homo sapiens) [TaxId: 9606]} mikrylqfvkpykyrifatiivgiikfgipmlipllikyaidgvinnhalttdekvhhlt iaigialfifvivrppiefirqylaqwtsnkilydirkklynhlqalsarfyannqvgqv isrvindveqtkdfiltglmniwldcitiiialsimffldvkltlaalfifpfyiltvyv ffgrlrkltrersqalaevqgflhervqgisvvksfaiedneaknfdkkntnfltralkh trwnaysfaaintvtdigpiivigvgaylaisgsitvgtlaafvgylellfgplrrlvas fttltqsfasmdrvfqlidedyd
Timeline for d4a82c1: