Lineage for d4a82b1 (4a82 B:1-323)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1959423Fold f.37: ABC transporter transmembrane region [90122] (1 superfamily)
    multihelical; complex architecture with several transmembrane helices
  4. 1959424Superfamily f.37.1: ABC transporter transmembrane region [90123] (1 family) (S)
    automatically mapped to Pfam PF00664
  5. 1959425Family f.37.1.1: ABC transporter transmembrane region [90124] (2 proteins)
  6. 1959440Protein Putative multidrug export ATP-binding/permease protein SAV1866 [144087] (2 species)
  7. 1959441Species Human (Homo sapiens) [TaxId:9606] [224951] (1 PDB entry)
  8. 1959443Domain d4a82b1: 4a82 B:1-323 [218704]
    Other proteins in same PDB: d4a82a2, d4a82b2, d4a82c2, d4a82d2
    automated match to d2hyda2

Details for d4a82b1

PDB Entry: 4a82 (more details), 2 Å

PDB Description: Fitted model of staphylococcus aureus sav1866 model ABC transporter in the human cystic fibrosis transmembrane conductance regulator volume map EMD-1966.
PDB Compounds: (B:) Cystic fibrosis transmembrane conductance regulator

SCOPe Domain Sequences for d4a82b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a82b1 f.37.1.1 (B:1-323) Putative multidrug export ATP-binding/permease protein SAV1866 {Human (Homo sapiens) [TaxId: 9606]}
mikrylqfvkpykyrifatiivgiikfgipmlipllikyaidgvinnhalttdekvhhlt
iaigialfifvivrppiefirqylaqwtsnkilydirkklynhlqalsarfyannqvgqv
isrvindveqtkdfiltglmniwldcitiiialsimffldvkltlaalfifpfyiltvyv
ffgrlrkltrersqalaevqgflhervqgisvvksfaiedneaknfdkkntnfltralkh
trwnaysfaaintvtdigpiivigvgaylaisgsitvgtlaafvgylellfgplrrlvas
fttltqsfasmdrvfqlidedyd

SCOPe Domain Coordinates for d4a82b1:

Click to download the PDB-style file with coordinates for d4a82b1.
(The format of our PDB-style files is described here.)

Timeline for d4a82b1: