SCOPe 2.08: Domain d4a82b1: 4a82 B:1-323

Lineage for d4a82b1 (4a82 B:1-323)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.37: ABC transporter transmembrane region [90122] (1 superfamily)
   multihelical; complex architecture with several transmembrane helices

4. Superfamily f.37.1: ABC transporter transmembrane region [90123] (2 families)
   automatically mapped to Pfam PF00664

5. Family f.37.1.1: ABC transporter transmembrane region [90124] (4 proteins)

6. Protein Putative multidrug export ATP-binding/permease protein SAV1866 [144087] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [224951] (1 PDB entry)

8. Domain d4a82b1: 4a82 B:1-323 [218704]
   Other proteins in same PDB: d4a82a2, d4a82b2, d4a82c2, d4a82d2
   automated match to d2hyda2

Details for d4a82b1

PDB Entry: 4a82, 2 Å

PDB Description: Fitted model of staphylococcus aureus sav1866 model ABC transporter in the human cystic fibrosis transmembrane conductance regulator volume map EMD-1966.

PDB Compounds: (B:) Cystic fibrosis transmembrane conductance regulator

SCOPe Domain Sequences for d4a82b1:

Sequence; same for both SEQRES and ATOM records:

>d4a82b1 f.37.1.1 (B:1-323) Putative multidrug export ATP-binding/permease protein SAV1866 {Human (Homo sapiens) [TaxId: 9606]}
mikrylqfvkpykyrifatiivgiikfgipmlipllikyaidgvinnhalttdekvhhlt
iaigialfifvivrppiefirqylaqwtsnkilydirkklynhlqalsarfyannqvgqv
isrvindveqtkdfiltglmniwldcitiiialsimffldvkltlaalfifpfyiltvyv
ffgrlrkltrersqalaevqgflhervqgisvvksfaiedneaknfdkkntnfltralkh
trwnaysfaaintvtdigpiivigvgaylaisgsitvgtlaafvgylellfgplrrlvas
fttltqsfasmdrvfqlidedyd

Timeline for d4a82b1:

• d4a82b1 first appeared in SCOPe 2.03
  
• d4a82b1 appears in SCOPe 2.07