Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.3: Bet v1-like [55961] (11 families) contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (5 proteins) |
Protein Major tree pollen allergen [55963] (4 species) |
Species White birch (Betula verrucosa), Bet v 1 [TaxId:3505] [55964] (19 PDB entries) |
Domain d4a80a_: 4a80 A: [218700] automated match to d4a85a_ complexed with 2an, so4 |
PDB Entry: 4a80 (more details), 1.96 Å
SCOPe Domain Sequences for d4a80a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4a80a_ d.129.3.1 (A:) Major tree pollen allergen {White birch (Betula verrucosa), Bet v 1 [TaxId: 3505]} gvfnyetettsvipaarlfkafildgdnlfpkvapqaissveniegnggpgtikkisfpe gfpfkyvkdrvdevdhtnfkynysvieggpigdtlekisneikivatpdggsilkisnky htkgdhevkaeqvkaskemgetllravesyllahsdayn
Timeline for d4a80a_: