SCOPe 2.08: Domain d4a2ba2: 4a2b A:200-392

Lineage for d4a2ba2 (4a2b A:200-392)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein Cell division protein FtsA [53078] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [53079] (3 PDB entries)

8. Domain d4a2ba2: 4a2b A:200-392 [218632]
   automated match to d1e4gt2
   complexed with ags, mg

Details for d4a2ba2

PDB Entry: 4a2b, 1.8 Å

PDB Description: Thermotoga maritima FtsA with ATP gamma S

PDB Compounds: (A:) cell division protein ftsa, putative

SCOPe Domain Sequences for d4a2ba2:

Sequence; same for both SEQRES and ATOM records:

>d4a2ba2 c.55.1.1 (A:200-392) Cell division protein FtsA {Thermotoga maritima [TaxId: 2336]}
ttpekdrgvvvvnlgynftgliaykngvpikisyvpvgmkhvikdvsavldtsfeeserl
iithgnavyndlkeeeiqyrgldgntiktttakklsviiharlreimskskkffreveak
iveegeigipggvvltgggakiprinelatevfkspvrtgcyansdrpsiinadevandp
sfaaafgnvfavs

Timeline for d4a2ba2:

• d4a2ba2 first appeared in SCOPe 2.03
  
• d4a2ba2 appears in SCOPe 2.07