PDB entry 4a2b

View 4a2b on RCSB PDB site
Description: Thermotoga maritima FtsA with ATP gamma S
Class: cell cycle
Keywords: cell cycle, actin-like, filament
Deposited on 2011-09-23, released 2012-04-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-05-30, with a file datestamp of 2012-05-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.1783
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cell division protein ftsa, putative
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4a2ba1, d4a2ba2
  • Heterogens: AGS, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4a2bA (A:)
    midlsktvfytsidigsryikglvlgkrdqewealafssvksrgldegeikdaiafkesv
    ntllkeleeqlqkslrsdfvisfssvsferedtvierdfgeekrsitldilsemqseale
    klkengktplhifskrylldderivfnpldmkaskiaieytsivvplkvyemfynflqdt
    vkspfqlksslvstaegvlttpekdrgvvvvnlgynftgliaykngvpikisyvpvgmkh
    vikdvsavldtsfeeserliithgnavyndlkeeeiqyrgldgntiktttakklsviiha
    rlreimskskkffreveakiveegeigipggvvltgggakiprinelatevfkspvrtgc
    yansdrpsiinadevandpsfaaafgnvfavsenpyeetpvksenplkkifrlfkelme
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a2bA (A:)
    tvfytsidigsryikglvlgkrdqewealafssvksrgldegeikdaiafkesvntllke
    leeqlqkslrsdfvisfssvsferedtvierdfgeekrsitldilsemqsealeklkeng
    ktplhifskrylldderivfnpldmkaskiaieytsivvplkvyemfynflqdtvkspfq
    lksslvstaegvlttpekdrgvvvvnlgynftgliaykngvpikisyvpvgmkhvikdvs
    avldtsfeeserliithgnavyndlkeeeiqyrgldgntiktttakklsviiharlreim
    skskkffreveakiveegeigipggvvltgggakiprinelatevfkspvrtgcyansdr
    psiinadevandpsfaaafgnvfavs