Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (181 species) not a true protein |
Species Thermus thermophilus HB8 [TaxId:300852] [187989] (16 PDB entries) |
Domain d3zznc1: 3zzn C:22-164 [218613] Other proteins in same PDB: d3zzna2, d3zznb2, d3zznc2, d3zznd2 automated match to d1llda1 complexed with adp; mutant |
PDB Entry: 3zzn (more details), 2.9 Å
SCOPe Domain Sequences for d3zznc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zznc1 c.2.1.0 (C:22-164) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvwag sygdlegaravvlaagvaqrpgetrlqlldrnaqvfaqvvprvleaapeavllvatnpvd vmtqvayalsglppgrvvgsg
Timeline for d3zznc1: