SCOPe 2.07: Domain d3zznb2: 3zzn B:165-331

Lineage for d3zznb2 (3zzn B:165-331)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.0: automated matches [227146] (1 protein)
   not a true family

6. Protein automated matches [226850] (47 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [225328] (7 PDB entries)

8. Domain d3zznb2: 3zzn B:165-331 [218612]
   Other proteins in same PDB: d3zzna1, d3zznb1, d3zznc1, d3zznd1
   automated match to d1llda2
   complexed with adp; mutant

Details for d3zznb2

PDB Entry: 3zzn, 2.9 Å

PDB Description: 5-mutant (r79w, r151a, e279a, e299a,e313a) lactate-dehydrogenase from thermus thermophillus

PDB Compounds: (B:) lactate dehydrogenase

SCOPe Domain Sequences for d3zznb2:

Sequence; same for both SEQRES and ATOM records:

>d3zznb2 d.162.1.0 (B:165-331) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
tildtarfrallaeylrvapqsvhayvlgehgdsevlvwssaqvggvpllefaeargral
spedraridegvrraayriiegkgatyygigaglarlvrailtdekgvytvsaftpevag
vlevslslprilgaggvagtvypslspeeraalrrsaeilkeaafalgf

Timeline for d3zznb2:

• d3zznb2 first appeared in SCOPe 2.03
  
• d3zznb2 appears in SCOPe 2.06
  
• d3zznb2 appears in the current release, SCOPe 2.08