Lineage for d3zzgb_ (3zzg B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2512581Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
    3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest
  4. 2512582Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) (S)
    the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase
  5. 2512735Family c.73.1.0: automated matches [191466] (1 protein)
    not a true family
  6. 2512736Protein automated matches [190728] (15 species)
    not a true protein
  7. 2512773Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [226376] (3 PDB entries)
  8. 2512783Domain d3zzgb_: 3zzg B: [218602]
    automated match to d2btya1

Details for d3zzgb_

PDB Entry: 3zzg (more details), 2.95 Å

PDB Description: Crystal structure of the amino acid kinase domain from Saccharomyces cerevisiae acetylglutamate kinase without ligands
PDB Compounds: (B:) acetylglutamate kinase

SCOPe Domain Sequences for d3zzgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zzgb_ c.73.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gfsatrstviqllnnistkreveqylkyftsvsqqqfavikvggaiisdnlhelasclaf
lyhvglypivlhgtgpqvngrleaqgiepdyidgiritdehtmavvrkcfleqnlklvta
leqlgvrarpitsgvftadyldkdkyklvgniksvtkepieasikagalpiltslaetas
gqmlnvnadvaagelarvfeplkivylnekggiingstgekisminldeeyddlmkqswv
kygtklkireikelldylprsssvaiinvqdlqkelftdsgagtmirrg

SCOPe Domain Coordinates for d3zzgb_:

Click to download the PDB-style file with coordinates for d3zzgb_.
(The format of our PDB-style files is described here.)

Timeline for d3zzgb_: