Lineage for d3zyka2 (3zyk A:149-288)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1481355Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 1481621Superfamily a.7.8: GAT-like domain [89009] (3 families) (S)
  5. 1481653Family a.7.8.0: automated matches [227302] (1 protein)
    not a true family
  6. 1481654Protein automated matches [227128] (1 species)
    not a true protein
  7. 1481655Species Norway rat (Rattus norvegicus) [TaxId:10116] [226791] (2 PDB entries)
  8. 1481658Domain d3zyka2: 3zyk A:149-288 [218584]
    Other proteins in same PDB: d3zyka1, d3zykb1
    automated match to d1hx8a1

Details for d3zyka2

PDB Entry: 3zyk (more details), 1.8 Å

PDB Description: structure of calm (picalm) anth domain
PDB Compounds: (A:) phosphatidylinositol-binding clathrin assembly protein

SCOPe Domain Sequences for d3zyka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zyka2 a.7.8.0 (A:149-288) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
krgadgvmrtmntekllktvpiiqnqmdalldfnvnsneltngvinaafmllfkdairlf
aaynegiinllekyfdmkknqckegldiykkfltrmtriseflkvaeqvgidrgdipdls
qapsslldaleqhlaslegk

SCOPe Domain Coordinates for d3zyka2:

Click to download the PDB-style file with coordinates for d3zyka2.
(The format of our PDB-style files is described here.)

Timeline for d3zyka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3zyka1