Class a: All alpha proteins [46456] (285 folds) |
Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.7.8: GAT-like domain [89009] (3 families) |
Family a.7.8.0: automated matches [227302] (1 protein) not a true family |
Protein automated matches [227128] (1 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [226791] (2 PDB entries) |
Domain d3zyka2: 3zyk A:149-288 [218584] Other proteins in same PDB: d3zyka1, d3zykb1 automated match to d1hx8a1 |
PDB Entry: 3zyk (more details), 1.8 Å
SCOPe Domain Sequences for d3zyka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zyka2 a.7.8.0 (A:149-288) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} krgadgvmrtmntekllktvpiiqnqmdalldfnvnsneltngvinaafmllfkdairlf aaynegiinllekyfdmkknqckegldiykkfltrmtriseflkvaeqvgidrgdipdls qapsslldaleqhlaslegk
Timeline for d3zyka2: