SCOP 1.67: Domain d1eh9a1: 1eh9 A:1-90

Lineage for d1eh9a1 (1eh9 A:1-90)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (18 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (16 proteins)
   domains of unknown function associated with different type of catalytic domains in a different sequential location
   subgroup of the larger IPT/TIG domain family

6. Protein Glycosyltrehalose trehalohydrolase, N-terminal domain N [49224] (1 species)
   domain architecture similar to isoamylase

7. Species Archaeon Sulfolobus solfataricus, km1 [TaxId:2287] [49225] (2 PDB entries)

8. Domain d1eh9a1: 1eh9 A:1-90 [21858]
   Other proteins in same PDB: d1eh9a2, d1eh9a3

Details for d1eh9a1

PDB Entry: 1eh9, 3 Å

PDB Description: crystal structure of sulfolobus solfataricus glycosyltrehalose trehalohydrolase

SCOP Domain Sequences for d1eh9a1:

Sequence; same for both SEQRES and ATOM records:

>d1eh9a1 b.1.18.2 (A:1-90) Glycosyltrehalose trehalohydrolase, N-terminal domain N {Archaeon Sulfolobus solfataricus, km1}
tfaykidgneviftlwapyqksvklkvlekglyemerdekgyftitlnnvkvrdrykyvl
ddaseipdpasryqpegvhgpsqiiqeske

Timeline for d1eh9a1:

• d1eh9a1 first appeared (with stable ids) in SCOP 1.55
  
• d1eh9a1 appears in SCOP 1.65
  
• d1eh9a1 appears in SCOP 1.69
  
• d1eh9a1 appears in the current release, SCOPe 2.08