Lineage for d1eh9a1 (1eh9 A:1-90)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 9579Family b.1.1.5: E set domains [49208] (23 proteins)
  6. 9679Protein Glycosyltrehalose trehalohydrolase, N-terminal domain [49224] (1 species)
  7. 9680Species Sulfolobus solfataricus, km1 [TaxId:2287] [49225] (2 PDB entries)
  8. 9681Domain d1eh9a1: 1eh9 A:1-90 [21858]
    Other proteins in same PDB: d1eh9a2, d1eh9a3

Details for d1eh9a1

PDB Entry: 1eh9 (more details), 3 Å

PDB Description: crystal structure of sulfolobus solfataricus glycosyltrehalose trehalohydrolase

SCOP Domain Sequences for d1eh9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eh9a1 b.1.1.5 (A:1-90) Glycosyltrehalose trehalohydrolase, N-terminal domain {Sulfolobus solfataricus, km1}
tfaykidgneviftlwapyqksvklkvlekglyemerdekgyftitlnnvkvrdrykyvl
ddaseipdpasryqpegvhgpsqiiqeske

SCOP Domain Coordinates for d1eh9a1:

Click to download the PDB-style file with coordinates for d1eh9a1.
(The format of our PDB-style files is described here.)

Timeline for d1eh9a1: