Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.14: N-(deoxy)ribosyltransferase-like [52309] (4 families) there are similar active site architectures as well as the catalytic mechanisms of functionally characterised members |
Family c.23.14.3: ADP ribosyl cyclase-like [56630] (3 proteins) contains extra N-terminal all-alpha subdomain automatically mapped to Pfam PF02267 |
Protein automated matches [191078] (1 species) not a true protein |
Species California sea hare (Aplysia californica) [TaxId:6500] [189008] (12 PDB entries) |
Domain d3zwyg_: 3zwy G: [218556] Other proteins in same PDB: d3zwyb2, d3zwyc2, d3zwyd2 automated match to d3zwna_ complexed with av1, cv1 |
PDB Entry: 3zwy (more details), 2.4 Å
SCOPe Domain Sequences for d3zwyg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zwyg_ c.23.14.3 (G:) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]} ivptrelenvflgrckdyeitryldilprvrsdcsalwkdffkafsfknpcdldlgsykd fftsaqqqlpknkvmfwsgvydeahdyantgrkyitledtlpgymlnslvwcgqranpgf nekvcpdfktcpvqaresfwgmasssyahsaegevtymvdgsnpkvpayrpdsffgkyel pnltnkvtrvkvivlhrlgekiiekcgagslldleklvkakhfafdcvenpravlfllcs dnpnarecrla
Timeline for d3zwyg_: