Lineage for d3ztdi_ (3ztd I:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2041484Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2041663Superfamily b.3.3: VHL [49468] (1 family) (S)
    automatically mapped to Pfam PF01847
  5. 2041664Family b.3.3.1: VHL [49469] (2 proteins)
  6. 2041665Protein VHL [49470] (1 species)
  7. 2041666Species Human (Homo sapiens) [TaxId:9606] [49471] (27 PDB entries)
  8. 2041746Domain d3ztdi_: 3ztd I: [218478]
    Other proteins in same PDB: d3ztda_, d3ztdb_, d3ztdd_, d3ztde_, d3ztdg_, d3ztdh_, d3ztdj_, d3ztdk_
    automated match to d1lqbc_
    complexed with ztd

Details for d3ztdi_

PDB Entry: 3ztd (more details), 2.79 Å

PDB Description: pVHL54-213-EloB-EloC complex _ methyl 4-(((2S,4R)-4-hydroxy-1-(2-(3- methylisoxazol-5-yl)acetyl)pyrrolidine-2-carboxamido)methyl)benzoate
PDB Compounds: (I:) von hippel-lindau disease tumor suppressor

SCOPe Domain Sequences for d3ztdi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ztdi_ b.3.3.1 (I:) VHL {Human (Homo sapiens) [TaxId: 9606]}
lrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrda
gthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldivr
slyedledhpnvqkdlerltqe

SCOPe Domain Coordinates for d3ztdi_:

Click to download the PDB-style file with coordinates for d3ztdi_.
(The format of our PDB-style files is described here.)

Timeline for d3ztdi_: