| Class b: All beta proteins [48724] (176 folds) |
| Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.3: VHL [49468] (1 family) ![]() automatically mapped to Pfam PF01847 |
| Family b.3.3.1: VHL [49469] (2 proteins) |
| Protein automated matches [193392] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [193393] (7 PDB entries) |
| Domain d3ztci_: 3ztc I: [218466] Other proteins in same PDB: d3ztca_, d3ztcb_, d3ztcd_, d3ztce_, d3ztcg_, d3ztch_, d3ztcj_, d3ztck_ automated match to d4awjf_ complexed with tr0 |
PDB Entry: 3ztc (more details), 2.65 Å
SCOPe Domain Sequences for d3ztci_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ztci_ b.3.3.1 (I:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd
agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv
rslyedledhpnvqkdlerltqeri
Timeline for d3ztci_: