SCOPe 2.03: Domain d3zpcb1: 3zpc B:3-150

Lineage for d3zpcb1 (3zpc B:3-150)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
   core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest

4. Superfamily c.97.1: Cytidine deaminase-like [53927] (6 families)
   contains extra C-terminal strand 5, order 21345

5. Family c.97.1.0: automated matches [191471] (1 protein)
   not a true family

6. Protein automated matches [190746] (9 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:470] [226627] (2 PDB entries)

8. Domain d3zpcb1: 3zpc B:3-150 [218393]
   Other proteins in same PDB: d3zpca2, d3zpcb2
   automated match to d2hxva2
   complexed with act, po4, zn

Details for d3zpcb1

PDB Entry: 3zpc, 2.2 Å

PDB Description: acinetobacter baumannii ribd, form 1

PDB Compounds: (B:) Riboflavin biosynthesis protein ribD

SCOPe Domain Sequences for d3zpcb1:

Sequence; same for both SEQRES and ATOM records:

>d3zpcb1 c.97.1.0 (B:3-150) automated matches {Acinetobacter baumannii [TaxId: 470]}
elkqdqywmqqaielakrglystkpnpnvgcvivkddqligegfhpkagqphaevfalrq
ageqaqgatayvtlepcahygrtppcaealvkaqvkkvvvacpdpnplvagkgvqilkna
gieveigicedlaaklnqgflkamstgm

Timeline for d3zpcb1:

• d3zpcb1 is new in SCOPe 2.03-stable
  
• d3zpcb1 appears in SCOPe 2.04
  
• d3zpcb1 appears in the current release, SCOPe 2.08