| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies) core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest |
Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) ![]() contains extra C-terminal strand 5, order 21345 |
| Family c.97.1.0: automated matches [191471] (1 protein) not a true family |
| Protein automated matches [190746] (16 species) not a true protein |
| Species Acinetobacter baumannii [TaxId:470] [226627] (2 PDB entries) |
| Domain d3zpcb1: 3zpc B:3-150 [218393] Other proteins in same PDB: d3zpca2, d3zpcb2 automated match to d2hxva2 complexed with act, po4, zn |
PDB Entry: 3zpc (more details), 2.2 Å
SCOPe Domain Sequences for d3zpcb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zpcb1 c.97.1.0 (B:3-150) automated matches {Acinetobacter baumannii [TaxId: 470]}
elkqdqywmqqaielakrglystkpnpnvgcvivkddqligegfhpkagqphaevfalrq
ageqaqgatayvtlepcahygrtppcaealvkaqvkkvvvacpdpnplvagkgvqilkna
gieveigicedlaaklnqgflkamstgm
Timeline for d3zpcb1: