Lineage for d3zpcb1 (3zpc B:3-150)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2918481Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 2918482Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) (S)
    contains extra C-terminal strand 5, order 21345
  5. 2918813Family c.97.1.0: automated matches [191471] (1 protein)
    not a true family
  6. 2918814Protein automated matches [190746] (16 species)
    not a true protein
  7. 2918815Species Acinetobacter baumannii [TaxId:470] [226627] (2 PDB entries)
  8. 2918818Domain d3zpcb1: 3zpc B:3-150 [218393]
    Other proteins in same PDB: d3zpca2, d3zpcb2
    automated match to d2hxva2
    complexed with act, po4, zn

Details for d3zpcb1

PDB Entry: 3zpc (more details), 2.2 Å

PDB Description: acinetobacter baumannii ribd, form 1
PDB Compounds: (B:) Riboflavin biosynthesis protein ribD

SCOPe Domain Sequences for d3zpcb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zpcb1 c.97.1.0 (B:3-150) automated matches {Acinetobacter baumannii [TaxId: 470]}
elkqdqywmqqaielakrglystkpnpnvgcvivkddqligegfhpkagqphaevfalrq
ageqaqgatayvtlepcahygrtppcaealvkaqvkkvvvacpdpnplvagkgvqilkna
gieveigicedlaaklnqgflkamstgm

SCOPe Domain Coordinates for d3zpcb1:

Click to download the PDB-style file with coordinates for d3zpcb1.
(The format of our PDB-style files is described here.)

Timeline for d3zpcb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3zpcb2