Lineage for d9cgta1 (9cgt A:495-579)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 160629Family b.1.1.5: E set domains [49208] (27 proteins)
  6. 160677Protein Cyclodextrin glycosyltransferase, domain E [49215] (5 species)
  7. 160678Species Bacillus circulans, different strains [TaxId:1397] [49216] (29 PDB entries)
  8. 160688Domain d9cgta1: 9cgt A:495-579 [21830]
    Other proteins in same PDB: d9cgta2, d9cgta3, d9cgta4

Details for d9cgta1

PDB Entry: 9cgt (more details), 2.5 Å

PDB Description: structure of cyclodextrin glycosyltransferase complexed with a thio- maltopentaose

SCOP Domain Sequences for d9cgta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d9cgta1 b.1.1.5 (A:495-579) Cyclodextrin glycosyltransferase, domain E {Bacillus circulans, different strains}
ettptighvgpvmgkpgnvvtidgrgfgstkgtvyfgttavtgaaitswedtqikvtips
vaagnyavkvaasgvnsnaynnfti

SCOP Domain Coordinates for d9cgta1:

Click to download the PDB-style file with coordinates for d9cgta1.
(The format of our PDB-style files is described here.)

Timeline for d9cgta1: