Lineage for d3zeua2 (3zeu A:108-230)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1605035Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1605036Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1606124Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 1606125Protein automated matches [226839] (42 species)
    not a true protein
  7. 1606457Species Salmonella enterica [TaxId:909946] [226624] (2 PDB entries)
  8. 1606459Domain d3zeua2: 3zeu A:108-230 [218278]
    automated match to d1okja2
    complexed with adp, ags, cl, mg, zn

Details for d3zeua2

PDB Entry: 3zeu (more details), 1.65 Å

PDB Description: structure of a salmonella typhimurium ygjd-yeaz heterodimer bound to atpgammas
PDB Compounds: (A:) putative m22 peptidase yeaz

SCOPe Domain Sequences for d3zeua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zeua2 c.55.1.0 (A:108-230) automated matches {Salmonella enterica [TaxId: 909946]}
atrvlaaidarmgevywaeyqrdaqgvwqgeeteavlkpervgerlkqlsgewatvgtgw
sawpdlakecgltlhdgevslpaaedmlpiasqklaagetvavehaepvylrnevawkkl
pgk

SCOPe Domain Coordinates for d3zeua2:

Click to download the PDB-style file with coordinates for d3zeua2.
(The format of our PDB-style files is described here.)

Timeline for d3zeua2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3zeua1